Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338836.1 | 3prime_partial | 182 | 206-751(+) |
Amino Acid sequence : | |||
MGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTK EAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFI | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 19,957.579 | ||
Theoretical pI: | 5.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 26.480 | ||
aromaticity | 0.082 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.214 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338836.1 | 3prime_partial | 182 | 206-751(+) |
Amino Acid sequence : | |||
MGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTK EAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFI | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 19,957.579 | ||
Theoretical pI: | 5.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 26.480 | ||
aromaticity | 0.082 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.214 | ||
sheet | 0.225 |