| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338851.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| APVRSATSFPCRKIQSTEAMEEFPDYKSLEIKRKSPDSRVFHLIFNRPSRGNALSPEFFTEFPHALSALDRNPEVAVIILSGAGKHFCSGIELQLLLTTTVPGEDWGRTGEKLRREIKEM QRAVTAVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPRIVGFGNAMDLALTARHFSGVEAKELGLVSRVYSDKAAMDEGVAQVAEGIAGRAPV AIMGTKRVVINSRDMS | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 12,911.687 | ||
| Theoretical pI: | 11.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 79.618 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.299 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338851.1 | complete | 117 | 428-75(-) |
Amino Acid sequence : | |||
| MQAPCTAAITGFLQSSTAVTARCISLISRRSFSPVRPQSSPGTVVVRRSWSSIPEQKCFPAPERMMTATSGLRSRAESAWGNSVKNSGERALPREGRLKIRWKTLESGDFRLISRDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,911.687 | ||
| Theoretical pI: | 11.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 79.618 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.299 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338851.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| APVRSATSFPCRKIQSTEAMEEFPDYKSLEIKRKSPDSRVFHLIFNRPSRGNALSPEFFTEFPHALSALDRNPEVAVIILSGAGKHFCSGIELQLLLTTTVPGEDWGRTGEKLRREIKEM QRAVTAVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPRIVGFGNAMDLALTARHFSGVEAKELGLVSRVYSDKAAMDEGVAQVAEGIAGRAPV AIMGTKRVVINSRDMS | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 12,911.687 | ||
| Theoretical pI: | 11.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 79.618 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.299 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338851.1 | complete | 117 | 428-75(-) |
Amino Acid sequence : | |||
| MQAPCTAAITGFLQSSTAVTARCISLISRRSFSPVRPQSSPGTVVVRRSWSSIPEQKCFPAPERMMTATSGLRSRAESAWGNSVKNSGERALPREGRLKIRWKTLESGDFRLISRDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,911.687 | ||
| Theoretical pI: | 11.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 79.618 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.299 | ||
| sheet | 0.231 | ||