Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338867.1	complete	200	153-755(+)
Amino Acid sequence :
MASSGNKNINAKLVLLGDVGTGKSSLVLRFVKGQFVEFEESTIGAAFFSQTVAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDLTNQASFDRAKKWVQELQAQGNPNMVMAL AGNKSDLLDARKVEAEEAQTYAQENGLFFMETSAKTAANVNEIFYEIAKRLPRLQQTPNPSGMVLVDRPAERASAASCCS*
Physicochemical properties
Number of amino acids:		200
Molecular weight:		21,829.447
Theoretical pI:		5.544
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20065
Instability index:		34.745
aromaticity		0.090
GRAVY		-0.191
Secondary Structure Fraction
Helix		0.275
turn		0.220
sheet		0.320