Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338867.1 | complete | 200 | 153-755(+) |
Amino Acid sequence : | |||
MASSGNKNINAKLVLLGDVGTGKSSLVLRFVKGQFVEFEESTIGAAFFSQTVAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDLTNQASFDRAKKWVQELQAQGNPNMVMAL AGNKSDLLDARKVEAEEAQTYAQENGLFFMETSAKTAANVNEIFYEIAKRLPRLQQTPNPSGMVLVDRPAERASAASCCS* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 21,829.447 | ||
Theoretical pI: | 5.544 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 34.745 | ||
aromaticity | 0.090 | ||
GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.220 | ||
sheet | 0.320 |