| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338876.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| HPLMALQNMDISLSTLQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAP LVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTD KLSYIGGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,534.680 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 42.817 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.224 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338876.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| HPLMALQNMDISLSTLQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAP LVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTD KLSYIGGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,534.680 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 42.817 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.224 | ||
| sheet | 0.286 | ||