Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338880.1 | 5prime_partial | 169 | 3-512(+) |
Amino Acid sequence : | |||
IDQLSSYPXFTPTSAMLRRVVPAFPLAVAAQTRLLASDQNASRTTQQDMMGKTSSMSSVPHSETMKRTATNAHQFEDTAASVNKAFKERQSQKKRDLPSQETSNKTSNTPRHDSSSDFAS GESGNAQKNSTASILDRRMQQASAGVSRDAPQNKAPGFFASIANALRGN* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 15,062.136 | ||
Theoretical pI: | 4.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50990 51240 | ||
Instability index: | 56.946 | ||
aromaticity | 0.128 | ||
GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.188 | ||
sheet | 0.338 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338880.1 | 3prime_partial | 134 | 403-2(-) |
Amino Acid sequence : | |||
MEAVEFFWALPDSPEAKSELESWRGVLLVLLDVSWDGRSLFFCDCLSLKALLTEAAVSSNWWALVAVRFMVSLWGTEDIEEVFPIMSCCVVRDAFWSEARRRVWAATARGKAGTTRRSMA EVGVKXGYEESWSI | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,062.136 | ||
Theoretical pI: | 4.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50990 51240 | ||
Instability index: | 56.946 | ||
aromaticity | 0.128 | ||
GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.188 | ||
sheet | 0.338 |