| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338895.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| SEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVA DSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNK | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 23,907.165 | ||
| Theoretical pI: | 5.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 47.654 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.852 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.252 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338895.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| SEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVA DSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNK | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 23,907.165 | ||
| Theoretical pI: | 5.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 47.654 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.852 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.252 | ||
| sheet | 0.224 | ||