| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338907.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| GSGGKGKMSNHSRKGKRKQKKMSAVQKLYEICKEVFADCGPGIVPSPENVEKLSAFLDGMTQADVGLRPNMPFFSSECAPVISYLQLHECDNFSIGIFCLPPNSVIPLHNHPGMTVFSKI LFGTMHIRSLDWTDDSDKSGDCAMSSISGLKTDVGRSEGSRLAKVKVNSEFTAPCRTSILYPSEGGNMHRFTAKTACAVLDVLGPPYSDDEGRHCQYYLEFPLAQSSVEKALPEKEEEAA AEGYA | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 26,679.058 | ||
| Theoretical pI: | 6.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
| Instability index: | 63.078 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.290 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338907.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| GSGGKGKMSNHSRKGKRKQKKMSAVQKLYEICKEVFADCGPGIVPSPENVEKLSAFLDGMTQADVGLRPNMPFFSSECAPVISYLQLHECDNFSIGIFCLPPNSVIPLHNHPGMTVFSKI LFGTMHIRSLDWTDDSDKSGDCAMSSISGLKTDVGRSEGSRLAKVKVNSEFTAPCRTSILYPSEGGNMHRFTAKTACAVLDVLGPPYSDDEGRHCQYYLEFPLAQSSVEKALPEKEEEAA AEGYA | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 26,679.058 | ||
| Theoretical pI: | 6.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
| Instability index: | 63.078 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.290 | ||
| sheet | 0.245 | ||