| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338919.1 | complete | 231 | 65-760(+) |
Amino Acid sequence : | |||
| MDSDFWTMRLAAAKRHIAAHNNHSSQSDRFNVEDFDGEEEARSDYPCPYCYEEFDIASLCSHLEADHSFESKSTVCPVCSVKVVSNVISHLTMQHGHLFKYQRHGRFRRVPFPNSQALSL LGRDLRDAHLQVLLGGSGFRSNSSASSTAATDNLLSSLVLNFPTSENDDISKSLLSSLEENSAKNSAPQHMWKSSFQSSLSCEEREQRIRQASGRAVFMQDLVASTLLPDK* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 25,831.381 | ||
| Theoretical pI: | 5.978 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 52.176 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.251 | ||
| turn | 0.277 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338919.1 | complete | 231 | 65-760(+) |
Amino Acid sequence : | |||
| MDSDFWTMRLAAAKRHIAAHNNHSSQSDRFNVEDFDGEEEARSDYPCPYCYEEFDIASLCSHLEADHSFESKSTVCPVCSVKVVSNVISHLTMQHGHLFKYQRHGRFRRVPFPNSQALSL LGRDLRDAHLQVLLGGSGFRSNSSASSTAATDNLLSSLVLNFPTSENDDISKSLLSSLEENSAKNSAPQHMWKSSFQSSLSCEEREQRIRQASGRAVFMQDLVASTLLPDK* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 25,831.381 | ||
| Theoretical pI: | 5.978 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 52.176 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.251 | ||
| turn | 0.277 | ||
| sheet | 0.260 | ||