Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338921.1 | 5prime_partial | 192 | 768-190(-) |
Amino Acid sequence : | |||
SITVLNTAQFRELALGLELAGRPFLWVVRRDSAGEGCFPAEFEARVGRRGKVVGWAPQQEVLAHPSVACFISHCGWNSTVEGVSSGVPFLCWPYFADQFCNQDYICDEWKVGLRLEKDEN GILTREEVKEKIESVVGDGGYKKRASNLRARVMDGVRGGKSHANFTNFVDWIHKTQSHCEVENSLLEAEVFI* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 19,761.718 | ||
Theoretical pI: | 11.217 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.556 | ||
aromaticity | 0.040 | ||
GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.306 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338921.1 | complete | 173 | 235-756(+) |
Amino Acid sequence : | |||
MRLCLMDPIHEISKIRVRFSSSNTIHNSSSKIRSSLFIPSITNNTLNFLLHFFSSQDPIFILLQSQSDLPLITNIVLITELIREIRPTQKRHSTANPLHSRIPPTMTYKTRHRRVGQHLL LGGPPHHLPPPPHPRLELRRKTSLSGGVPPHHPQKRPAGELEPEGELPELRRV* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 19,761.718 | ||
Theoretical pI: | 11.217 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.556 | ||
aromaticity | 0.040 | ||
GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.306 | ||
sheet | 0.214 |