Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338937.1 | complete | 167 | 70-573(+) |
Amino Acid sequence : | |||
MKCVGDLLHDHFKSNPHQTSTISPDKVTNFTLHDGQLEKTNSVIGWKIILGGKERHFKQVVDIDDAAKSMTFNFIEGYMNELYNSMTVILTAKENWITWSIVYEKMNENVPEPLNLWSFI LASSRTLRLTMSENRYQSSFPINSKIEYCYYPKSLRINKTICVIYVS* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 19,396.046 | ||
Theoretical pI: | 7.717 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 34.343 | ||
aromaticity | 0.114 | ||
GRAVY | -0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.246 | ||
sheet | 0.198 |