| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338938.1 | internal | 123 | 370-2(-) |
Amino Acid sequence : | |||
| PFKSNPPQTSPIFPVKVRNFPLQEGQLEKNNFVFGWKIFLGGKEGHFKQVVAIDVAAKSMPFNFFGGFMNEFFNSMAVFFTAKENWITWGIVLEKKKENVPGPLNFWGFILASSRALGFP MWE | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,069.190 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27500 | ||
| Instability index: | 29.937 | ||
| aromaticity | 0.187 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.301 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338938.1 | internal | 123 | 370-2(-) |
Amino Acid sequence : | |||
| PFKSNPPQTSPIFPVKVRNFPLQEGQLEKNNFVFGWKIFLGGKEGHFKQVVAIDVAAKSMPFNFFGGFMNEFFNSMAVFFTAKENWITWGIVLEKKKENVPGPLNFWGFILASSRALGFP MWE | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,069.190 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27500 | ||
| Instability index: | 29.937 | ||
| aromaticity | 0.187 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.301 | ||
| sheet | 0.211 | ||