| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338954.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
| APVFIPCKMVDLDWKTKMITSEISSKSPKLSNKLQITIPQPRIRLPELSAASDSSCSAYENYLRLPELRKLWDSTEFPEWKSESLLKPAFTGLEITFRFISTVLSDVRPYANRREWRRRI EALAMTEIEIIALLCEEDEDDEETRATIPIVDLTSTAGPLAPKNSSAEVWKMADDKVVVSHVSEESLLPQLATWQRFEDVARKIQYSIECQMQGFPYTLGLGEPNLSGKPSLDYDRICKP RELHKLKRCPHDDVESNNLENRTLYST | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,593.555 | ||
| Theoretical pI: | 5.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43805 | ||
| Instability index: | 59.252 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.221 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338954.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
| APVFIPCKMVDLDWKTKMITSEISSKSPKLSNKLQITIPQPRIRLPELSAASDSSCSAYENYLRLPELRKLWDSTEFPEWKSESLLKPAFTGLEITFRFISTVLSDVRPYANRREWRRRI EALAMTEIEIIALLCEEDEDDEETRATIPIVDLTSTAGPLAPKNSSAEVWKMADDKVVVSHVSEESLLPQLATWQRFEDVARKIQYSIECQMQGFPYTLGLGEPNLSGKPSLDYDRICKP RELHKLKRCPHDDVESNNLENRTLYST | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,593.555 | ||
| Theoretical pI: | 5.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43805 | ||
| Instability index: | 59.252 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.221 | ||
| sheet | 0.285 | ||