Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338958.1	5prime_partial	126	3-383(+)
Amino Acid sequence :
TSEAKMAISTLNPEAPIFVPLAYRAVEDFSDEWWDLVQCSPWFRDYWLRECFSDPQIDLSQFLHHDGDDEILFDDALSEGKESGRDLVAAGWMKWRKPKAEMPRFSEKAPKIVNMKVKPR PIQQPR*
Physicochemical properties
Number of amino acids:		126
Molecular weight:		14,726.567
Theoretical pI:		5.035
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35980 36105
Instability index:		43.077
aromaticity		0.119
GRAVY		-0.621
Secondary Structure Fraction
Helix		0.286
turn		0.206
sheet		0.262