| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338958.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
| TSEAKMAISTLNPEAPIFVPLAYRAVEDFSDEWWDLVQCSPWFRDYWLRECFSDPQIDLSQFLHHDGDDEILFDDALSEGKESGRDLVAAGWMKWRKPKAEMPRFSEKAPKIVNMKVKPR PIQQPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,726.567 | ||
| Theoretical pI: | 5.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 36105 | ||
| Instability index: | 43.077 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.206 | ||
| sheet | 0.262 | ||