Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338958.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
TSEAKMAISTLNPEAPIFVPLAYRAVEDFSDEWWDLVQCSPWFRDYWLRECFSDPQIDLSQFLHHDGDDEILFDDALSEGKESGRDLVAAGWMKWRKPKAEMPRFSEKAPKIVNMKVKPR PIQQPR* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,726.567 | ||
Theoretical pI: | 5.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 36105 | ||
Instability index: | 43.077 | ||
aromaticity | 0.119 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.206 | ||
sheet | 0.262 |