| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338967.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| APLFLLSSIHKMSEKQSSPIVNNEEMERIIEQLPKIDYFWNNYQLYQWEGFWSTLIILKAAMVFKATFKTKPNDFLLASSIKTGTTWLKSICIAIMQAGNKEEEEDLLVKDNPHFYVQTI ETMDYYSKTLTDDLYTMPSPRLFHTHLPYRVLPDSIKNSDNCKIIYITRNPKDTLISAWHFFNNRKRLEDLTPLEVVVESFCKGVHLYGPFFEHVLEYWEESKKNPQKILFLKYEDLKID PKKEVAKIALF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 29,631.908 | ||
| Theoretical pI: | 6.433 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 41.300 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.191 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338967.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| APLFLLSSIHKMSEKQSSPIVNNEEMERIIEQLPKIDYFWNNYQLYQWEGFWSTLIILKAAMVFKATFKTKPNDFLLASSIKTGTTWLKSICIAIMQAGNKEEEEDLLVKDNPHFYVQTI ETMDYYSKTLTDDLYTMPSPRLFHTHLPYRVLPDSIKNSDNCKIIYITRNPKDTLISAWHFFNNRKRLEDLTPLEVVVESFCKGVHLYGPFFEHVLEYWEESKKNPQKILFLKYEDLKID PKKEVAKIALF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 29,631.908 | ||
| Theoretical pI: | 6.433 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 41.300 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.191 | ||
| sheet | 0.251 | ||