| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338969.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
| TGYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRW LNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIHKTFYNHGYDHAFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 11,545.061 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 44.794 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338969.1 | 3prime_partial | 101 | 305-3(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVAG | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,545.061 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 44.794 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338969.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
| TGYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRW LNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIHKTFYNHGYDHAFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 11,545.061 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 44.794 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338969.1 | 3prime_partial | 101 | 305-3(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVAG | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,545.061 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 44.794 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||