Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	3prime_partial	175	184-708(+)
Amino Acid sequence :
MRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLESIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHG TAIGRLVEAFPWVRGIAFDLPDIVADAPPRKGVDFFGGDMFESVPKADAVMLMWI
Physicochemical properties
Number of amino acids:		175
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	5prime_partial	127	3-386(+)
Amino Acid sequence :
HPLATSCTSMGARPTLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPLAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKP LSRVDQR*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	complete	125	420-43(-)
Amino Acid sequence :
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVR*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	3prime_partial	175	184-708(+)
Amino Acid sequence :
MRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLESIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHG TAIGRLVEAFPWVRGIAFDLPDIVADAPPRKGVDFFGGDMFESVPKADAVMLMWI
Physicochemical properties
Number of amino acids:		175
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	5prime_partial	127	3-386(+)
Amino Acid sequence :
HPLATSCTSMGARPTLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPLAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKP LSRVDQR*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338971.1	complete	125	420-43(-)
Amino Acid sequence :
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVR*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,162.004
Theoretical pI:		11.623
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		72.115
aromaticity		0.040
GRAVY		-0.711
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264