| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338976.1 | 5prime_partial | 171 | 3-518(+) |
Amino Acid sequence : | |||
| TSQNPSPSRFTDSFHLSSNDHMPLNYLGNSSSTPNDFFHSSSLLSNTTTANTCHPSTFDNSPKCQGFQDAVSTNTYEGDQSMDFFTTERSDSGLLQEVIDRFFPKVKSETTQALPVAEME NGSSHLFGMEASSNSYPYNYCSEFQAANGILGDIFHYQEALSLVAGKVPNA* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,738.063 | ||
| Theoretical pI: | 4.576 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 49.735 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.566 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.351 | ||
| sheet | 0.205 | ||