| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338983.1 | 5prime_partial | 175 | 1-528(+) |
Amino Acid sequence : | |||
| IPLYISSPKFPCSSEMGSEGSSRVVVPRNFRLLEELERGEKGIGDGTVSYGMDDVYDVYMQSWTGTIIGPPNTVHEGRIYQLKLFCGKDYPDNPPAVRFQSGINMSCVNQETGVVEPSHF PMLADWKRECTMEDILMQLKKEMTSPQNRKLAQPPDGNEEARPEQKGIVIRCCIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,675.284 | ||
| Theoretical pI: | 5.138 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 48.226 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.286 | ||
| sheet | 0.217 | ||