Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338988.1 | 3prime_partial | 210 | 71-700(+) |
Amino Acid sequence : | |||
MANGGGEGVRPFPDFDLPDHILAVIPTDPYDQLDLARKISSMAIASRVTMLETEAERLRHKLHEKDRFVEELQDKVVHLEAAFQDAEFRLKITREENVKLLNERDSLAMTAKKLTRDLAK LETFKKQLMQSLTDENSPPETVGVGTYVSVPKSNYMNDESNGYAKHHSYSSSTDNASPEEEVSKHDGQKISITPFITPSGTPTSVSTNVS | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,433.941 | ||
Theoretical pI: | 5.293 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 44.311 | ||
aromaticity | 0.057 | ||
GRAVY | -0.640 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.238 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338988.1 | 3prime_partial | 210 | 71-700(+) |
Amino Acid sequence : | |||
MANGGGEGVRPFPDFDLPDHILAVIPTDPYDQLDLARKISSMAIASRVTMLETEAERLRHKLHEKDRFVEELQDKVVHLEAAFQDAEFRLKITREENVKLLNERDSLAMTAKKLTRDLAK LETFKKQLMQSLTDENSPPETVGVGTYVSVPKSNYMNDESNGYAKHHSYSSSTDNASPEEEVSKHDGQKISITPFITPSGTPTSVSTNVS | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,433.941 | ||
Theoretical pI: | 5.293 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 44.311 | ||
aromaticity | 0.057 | ||
GRAVY | -0.640 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.238 | ||
sheet | 0.271 |