| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338999.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
| HHLTYQVVSTRTDTYYVWDGVRSWRVDLSNRSCTCGEFQLDLIPCSHAAAAIRMTNVNFYDYVAEYYYTLMWHEVYCGEIRELPDKDNWVIPPATQALTVHPPIIDRQAGRPRSSRIPSG VEASQTSTHRSSQAEASASSSRAPKKCSIYKNTGHTKRKCPSQNE* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,771.758 | ||
| Theoretical pI: | 8.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
| Instability index: | 44.667 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.242 | ||
| sheet | 0.182 | ||