Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338999.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
HHLTYQVVSTRTDTYYVWDGVRSWRVDLSNRSCTCGEFQLDLIPCSHAAAAIRMTNVNFYDYVAEYYYTLMWHEVYCGEIRELPDKDNWVIPPATQALTVHPPIIDRQAGRPRSSRIPSG VEASQTSTHRSSQAEASASSSRAPKKCSIYKNTGHTKRKCPSQNE* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,771.758 | ||
Theoretical pI: | 8.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
Instability index: | 44.667 | ||
aromaticity | 0.097 | ||
GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.242 | ||
sheet | 0.182 |