| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339009.1 | internal | 260 | 780-1(-) |
Amino Acid sequence : | |||
| RKGCLGYIKYVLKNSLMKLPIFGWGFHILEFIPVQRKWEADESLMRGMLSNFSNRQDALWLAVFPEGTDYTEQKCARSQKFATENGLQILKNVLLPKTRGFSVCLEILRGSLDAVYDVTI AYKNRCPSFMDNVFGVDPSEVHMHIRRIPLDKIPLSGREAAAATWLMDAFVLKDQLLTDFIVNGHFPREGTEKQLSTVKCASNCAVVIALTVIFSFLTFFSSVWFKVYVGLACVYLACAS YFGFRPNPIVKPVLKSTPQE | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,427.093 | ||
| Theoretical pI: | 8.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39920 | ||
| Instability index: | 36.306 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.212 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339009.1 | internal | 260 | 780-1(-) |
Amino Acid sequence : | |||
| RKGCLGYIKYVLKNSLMKLPIFGWGFHILEFIPVQRKWEADESLMRGMLSNFSNRQDALWLAVFPEGTDYTEQKCARSQKFATENGLQILKNVLLPKTRGFSVCLEILRGSLDAVYDVTI AYKNRCPSFMDNVFGVDPSEVHMHIRRIPLDKIPLSGREAAAATWLMDAFVLKDQLLTDFIVNGHFPREGTEKQLSTVKCASNCAVVIALTVIFSFLTFFSSVWFKVYVGLACVYLACAS YFGFRPNPIVKPVLKSTPQE | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,427.093 | ||
| Theoretical pI: | 8.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39920 | ||
| Instability index: | 36.306 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.212 | ||
| sheet | 0.246 | ||