Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339013.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
APVIVPNSARGYVWEPQAGGSFTVTRDTSGENIGRGTKMTLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWVEKTTEKEISDDEDEEDKKDEEGKVEEVDEEKEKAEKKKKKIKEVS HEWDLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDNKKKPNNIKLYVRRVFIMDNCEELIPEYLSFVKGIVDSEDLPLNISREMLQ QNKIXEVIRKNL | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 25,724.049 | ||
Theoretical pI: | 4.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.854 | ||
aromaticity | 0.043 | ||
GRAVY | 0.600 | ||
Secondary Structure Fraction | |||
Helix | 0.483 | ||
turn | 0.187 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339013.1 | 5prime_partial | 231 | 756-61(-) |
Amino Acid sequence : | |||
QVLADNFXDLVLLQHLTGDVEREILGVDDTLDKAQILRNQLLTVVHDEDTTNIELNVVGLLLVVEEVKRCPLGNEKDGLEFELPLNRKVLHSQVLLPVVREAFVEGRILLLGDLLGLPHP DRLLLVNQVPLVGNLLDLLLFLLGFLLLFINFLDLPFLVLLVLLILIIRNLLLGGLLNPQRDRVADEFRVLLDQILQPALLKILELILLQVESHLSSPANVFTGSISSHSE* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,724.049 | ||
Theoretical pI: | 4.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.854 | ||
aromaticity | 0.043 | ||
GRAVY | 0.600 | ||
Secondary Structure Fraction | |||
Helix | 0.483 | ||
turn | 0.187 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339013.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
APVIVPNSARGYVWEPQAGGSFTVTRDTSGENIGRGTKMTLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWVEKTTEKEISDDEDEEDKKDEEGKVEEVDEEKEKAEKKKKKIKEVS HEWDLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDNKKKPNNIKLYVRRVFIMDNCEELIPEYLSFVKGIVDSEDLPLNISREMLQ QNKIXEVIRKNL | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 25,724.049 | ||
Theoretical pI: | 4.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.854 | ||
aromaticity | 0.043 | ||
GRAVY | 0.600 | ||
Secondary Structure Fraction | |||
Helix | 0.483 | ||
turn | 0.187 | ||
sheet | 0.370 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339013.1 | 5prime_partial | 231 | 756-61(-) |
Amino Acid sequence : | |||
QVLADNFXDLVLLQHLTGDVEREILGVDDTLDKAQILRNQLLTVVHDEDTTNIELNVVGLLLVVEEVKRCPLGNEKDGLEFELPLNRKVLHSQVLLPVVREAFVEGRILLLGDLLGLPHP DRLLLVNQVPLVGNLLDLLLFLLGFLLLFINFLDLPFLVLLVLLILIIRNLLLGGLLNPQRDRVADEFRVLLDQILQPALLKILELILLQVESHLSSPANVFTGSISSHSE* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,724.049 | ||
Theoretical pI: | 4.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.854 | ||
aromaticity | 0.043 | ||
GRAVY | 0.600 | ||
Secondary Structure Fraction | |||
Helix | 0.483 | ||
turn | 0.187 | ||
sheet | 0.370 |