Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339033.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
APLNTESVGDSALCTPCEMAVVWMKSQLNNEGVKDSVIAYVNQLCDKIPSPSGESIIDCNALPNMPNITFTIGGKPYVLAPEQYILKVEQGPQSICMSGFMALDVPPPRGPLWILGDVFM GPYHTVFDYGNSRLGFAEAA* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,083.202 | ||
Theoretical pI: | 4.395 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 58.836 | ||
aromaticity | 0.086 | ||
GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.314 | ||
sheet | 0.243 |