| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339033.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
| APLNTESVGDSALCTPCEMAVVWMKSQLNNEGVKDSVIAYVNQLCDKIPSPSGESIIDCNALPNMPNITFTIGGKPYVLAPEQYILKVEQGPQSICMSGFMALDVPPPRGPLWILGDVFM GPYHTVFDYGNSRLGFAEAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,083.202 | ||
| Theoretical pI: | 4.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 58.836 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.314 | ||
| sheet | 0.243 | ||