Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339035.1 | 5prime_partial | 130 | 1-393(+) |
Amino Acid sequence : | |||
ARGVQSKTLKICANHLVLPTMSIQEHAGNEKSCVWHAADFADGELKDETFCIRFASVENCKAFKEKVEEIAESQQTKSGESEEAGAAATELIEKLSVESKDKNDQPEDKEAPAATEEKED KKEENADEKN* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,940.863 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 56.818 | ||
aromaticity | 0.071 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.131 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339035.1 | complete | 99 | 140-439(+) |
Amino Acid sequence : | |||
MRLFASALLQLRIARLSKRRLKKSLNLNRQSLEKVKKLVLLLLNLLKSLVLKAKIKMTNLKTKRPLQLQRKRKIRRKRMLMKRIKMFVFVGQSFSFFLF* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,940.863 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 56.818 | ||
aromaticity | 0.071 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.131 | ||
sheet | 0.333 |