| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| FSKLNPKFPLAPKMVTSFRRSLSFPNPPSHISSKPQKALHVRSTSLPCRSHPIISQLRDEISALESWSAAASDARTAAWLCDGLLRLKSVHESLDDLLHLPQTRESLHGGDYSSLVEKLL EDFLRFVDVYGNFQTLLLRLKEEYSAAQIAVRRKDNARVAVHSKNLNKVAKEIGKLSSSFLSIGKPAASAPPRPSYDEEAELVDVIDGVVKATVAVSNALFGGVSNSAAFRKPSCMGLSF GRKTKNVKVEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | 5prime_partial | 188 | 756-190(-) |
Amino Acid sequence : | |||
| SPLNLHILRLPPKAQPHARRLPERRRVRNPSEQRVRHRYRRLHHAVDDIHELRLLVIRRPRRSRGRRFTNGQETGREFSDLLGDFVQILRMNSDSRVILPPDSDLRGGVLLLQPEEERLE VSIDVDESEEVFEKLLDEAGVVAAVERLASLGEVEEIVERFVDGFEAEEAVAEPGGRASVGGRGGPGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | complete | 108 | 141-467(+) |
Amino Acid sequence : | |||
| MPIAPDYFPAPRRDLRPRVLVRRGLRRSHGRLALRRPPPPQIRPRIARRSPPPPPDSRVSPRRRLLQPRREASRRLPQIRRRLWKLPDAPPPAEGGVLRRADRCQEEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| FSKLNPKFPLAPKMVTSFRRSLSFPNPPSHISSKPQKALHVRSTSLPCRSHPIISQLRDEISALESWSAAASDARTAAWLCDGLLRLKSVHESLDDLLHLPQTRESLHGGDYSSLVEKLL EDFLRFVDVYGNFQTLLLRLKEEYSAAQIAVRRKDNARVAVHSKNLNKVAKEIGKLSSSFLSIGKPAASAPPRPSYDEEAELVDVIDGVVKATVAVSNALFGGVSNSAAFRKPSCMGLSF GRKTKNVKVEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | 5prime_partial | 188 | 756-190(-) |
Amino Acid sequence : | |||
| SPLNLHILRLPPKAQPHARRLPERRRVRNPSEQRVRHRYRRLHHAVDDIHELRLLVIRRPRRSRGRRFTNGQETGREFSDLLGDFVQILRMNSDSRVILPPDSDLRGGVLLLQPEEERLE VSIDVDESEEVFEKLLDEAGVVAAVERLASLGEVEEIVERFVDGFEAEEAVAEPGGRASVGGRGGPGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339056.1 | complete | 108 | 141-467(+) |
Amino Acid sequence : | |||
| MPIAPDYFPAPRRDLRPRVLVRRGLRRSHGRLALRRPPPPQIRPRIARRSPPPPPDSRVSPRRRLLQPRREASRRLPQIRRRLWKLPDAPPPAEGGVLRRADRCQEEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,667.706 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 148.250 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.296 | ||
| sheet | 0.222 | ||