| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| TSHNSIKMALNLSLTSKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAG GADEEIEKLRNFGLCAGTMRALMEVGN | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | complete | 165 | 505-8(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLEVRERFRAILIEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
| HQSQFNQNGSKSLSHLQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| TSHNSIKMALNLSLTSKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAG GADEEIEKLRNFGLCAGTMRALMEVGN | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | complete | 165 | 505-8(-) |
Amino Acid sequence : | |||
| MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLEVRERFRAILIEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339071.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
| HQSQFNQNGSKSLSHLQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,925.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 92.782 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||