Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	internal	267	3-803(+)
Amino Acid sequence :
TSHNSIKMALNLSLTSKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAG GADEEIEKLRNFGLCAGTMRALMEVGN
Physicochemical properties
Number of amino acids:		267
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	complete	165	505-8(-)
Amino Acid sequence :
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLEVRERFRAILIEL*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	5prime_partial	148	2-448(+)
Amino Acid sequence :
HQSQFNQNGSKSLSHLQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	internal	267	3-803(+)
Amino Acid sequence :
TSHNSIKMALNLSLTSKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAG GADEEIEKLRNFGLCAGTMRALMEVGN
Physicochemical properties
Number of amino acids:		267
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	complete	165	505-8(-)
Amino Acid sequence :
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLEVRERFRAILIEL*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339071.1	5prime_partial	148	2-448(+)
Amino Acid sequence :
HQSQFNQNGSKSLSHLQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		16,925.054
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		92.782
aromaticity		0.014
GRAVY		-1.341
Secondary Structure Fraction
Helix		0.149
turn		0.324
sheet		0.176