| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339089.1 | complete | 125 | 564-187(-) |
Amino Acid sequence : | |||
| MSDKITPVRVIVYLLKPDLFTTYSHSLVVLSFRVSVKANIAISNAKLTSSYMSSSPSLITTCTIITFPVSLGIASLQFFSISTHSSSLQSCSTHMVKTASALGTCSNMFPPTCSTPSWWG AAAAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,953.702 | ||
| Theoretical pI: | 4.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.710 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.116 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339089.1 | complete | 112 | 242-580(+) |
Amino Acid sequence : | |||
| MFEQVPKADAVFTMCVLHDWSDEECVEILKNCKEAIPRETGKVIIVQVVIKEGEEDIYDDVNLALDMAMLAFTDTRKERTTKEWEYVVNKSGFRRYTITRTGVILSDIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,953.702 | ||
| Theoretical pI: | 4.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.710 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.116 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339089.1 | complete | 125 | 564-187(-) |
Amino Acid sequence : | |||
| MSDKITPVRVIVYLLKPDLFTTYSHSLVVLSFRVSVKANIAISNAKLTSSYMSSSPSLITTCTIITFPVSLGIASLQFFSISTHSSSLQSCSTHMVKTASALGTCSNMFPPTCSTPSWWG AAAAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,953.702 | ||
| Theoretical pI: | 4.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.710 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.116 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339089.1 | complete | 112 | 242-580(+) |
Amino Acid sequence : | |||
| MFEQVPKADAVFTMCVLHDWSDEECVEILKNCKEAIPRETGKVIIVQVVIKEGEEDIYDDVNLALDMAMLAFTDTRKERTTKEWEYVVNKSGFRRYTITRTGVILSDIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,953.702 | ||
| Theoretical pI: | 4.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.710 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.116 | ||
| sheet | 0.268 | ||