Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339090.1 | 5prime_partial | 160 | 665-183(-) |
Amino Acid sequence : | |||
FGGCGGADGTAISAIVKGCPWIRGINFDLPHVAAAAPHHDGVEHVGGNMFEQVPKADGVFTMCVVHDWSDEECVEILKNCKEAIPKETGKVIIVEVVIKEGEEDKYGDVNLALDMAMLAF TDTGKERTTKEWEYVVNKSGFSRYTITHTGVILSVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 13,256.234 | ||
Theoretical pI: | 8.799 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 47.001 | ||
aromaticity | 0.096 | ||
GRAVY | 0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.312 | ||
sheet | 0.184 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339090.1 | complete | 125 | 199-576(+) |
Amino Acid sequence : | |||
MTDKITPVCVIVYLLKPDLFTTYSHSLVVLSFPVSVKANIAISNAKLTSPYLSSSPSLITTSTIITFPVSFGIASLQFFSISTHSSSLQSCTTHMVKTPSALGTCSNMFPPTCSTPSWWG AAAAT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,256.234 | ||
Theoretical pI: | 8.799 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 47.001 | ||
aromaticity | 0.096 | ||
GRAVY | 0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.312 | ||
sheet | 0.184 |