| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339096.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| AEEMASAQLTSAASSISAAKGFASFEGLRATQSVKISSFSPLKQNGLSLRSSRGLVVKAATTVTHKYTSLKPLGDRLLVKIKTAEEKTIGGILLPTTAQSKPQGGEVVAVGEGRTVGKNK VEVGVQTGAQVVYSKYAGTEVEFNGSNHLILKEDDIVGILETDDIKDLKPLNDRVLIKVAEAEEKTAGGLYLTDASKEKPSIGTVVAVGPGPLDEEGNRKP | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 23,146.037 | ||
| Theoretical pI: | 8.051 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 25.541 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.258 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339096.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| AEEMASAQLTSAASSISAAKGFASFEGLRATQSVKISSFSPLKQNGLSLRSSRGLVVKAATTVTHKYTSLKPLGDRLLVKIKTAEEKTIGGILLPTTAQSKPQGGEVVAVGEGRTVGKNK VEVGVQTGAQVVYSKYAGTEVEFNGSNHLILKEDDIVGILETDDIKDLKPLNDRVLIKVAEAEEKTAGGLYLTDASKEKPSIGTVVAVGPGPLDEEGNRKP | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 23,146.037 | ||
| Theoretical pI: | 8.051 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 25.541 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.258 | ||
| sheet | 0.276 | ||