| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339100.1 | complete | 217 | 52-705(+) |
Amino Acid sequence : | |||
| MARDKIQIKKIDNVTARQVTFSKRRRGLFKKAQELSVLCDADVALIIFSSTGKLFEYASSSMKEILGRHNLQSENLEKPCLEVAEDSNLSRLSKEVAERSHQLRRMRGEELQELSIQELQ QLEKSLELGLSRVIEKKGEKIMKEINQLQEKGMKLMDENKRLRMQVIDLSKRTEEESEVVVYEEGQSSESVTNAGAAPPQDYDSSDTSLKLGLPYIG* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,690.894 | ||
| Theoretical pI: | 5.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 65.340 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.650 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.207 | ||
| sheet | 0.327 | ||