Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339103.1 | 5prime_partial | 212 | 1-639(+) |
Amino Acid sequence : | |||
APFLTAGTDTTAIISQWTIAELINNPTVLKKAQNEIDTVVGVDRLLQESDAPNLPYLNAVIKETFRLHPPIPMLSRKSISDCVIGGYTIPADTLLFVNIWSMGRNPNIWENPTEFWPERF LEKENAEIDIKGQDFELLPFGTGRRGCPGMLLAIQEVTSVIGTMIQCFDWKLPAGDGSSRVDMTERPGLTAPRAEDLVCRVVPRVDALVVSS* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 12,499.787 | ||
Theoretical pI: | 11.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 93.244 | ||
aromaticity | 0.048 | ||
GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
Helix | 0.162 | ||
turn | 0.219 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339103.1 | 5prime_partial | 177 | 756-223(-) |
Amino Acid sequence : | |||
RDRPPYEGSGNYPPWWGRISPTYHAKMYNKTSKFKLFLLLTRNNQSINSRHHTTNQILRPRRREPRSLRHVDAAGTVAGGQFPVKALDHGPNHTCHLLNGQQHPRAAPPARSKRKKLEIL PFNINLGVFLLQKSLRPELRRIFPNVRVPPHRPNVDEQQRVCRNRVAADHAVGDRFS* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 12,499.787 | ||
Theoretical pI: | 11.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 93.244 | ||
aromaticity | 0.048 | ||
GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
Helix | 0.162 | ||
turn | 0.219 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339103.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
TIFDRRHRHDGDHLPMDNSRAHQQPYRPEESSKRDRHSRRSRQTFAGIRRPKFALPQRRHQRNFPASPSDPHALKKIDLRLRDRRLHDSGRHAAVRQHLVDGAEP* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,499.787 | ||
Theoretical pI: | 11.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 93.244 | ||
aromaticity | 0.048 | ||
GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
Helix | 0.162 | ||
turn | 0.219 | ||
sheet | 0.181 |