| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339103.1 | 5prime_partial | 212 | 1-639(+) |
Amino Acid sequence : | |||
| APFLTAGTDTTAIISQWTIAELINNPTVLKKAQNEIDTVVGVDRLLQESDAPNLPYLNAVIKETFRLHPPIPMLSRKSISDCVIGGYTIPADTLLFVNIWSMGRNPNIWENPTEFWPERF LEKENAEIDIKGQDFELLPFGTGRRGCPGMLLAIQEVTSVIGTMIQCFDWKLPAGDGSSRVDMTERPGLTAPRAEDLVCRVVPRVDALVVSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 12,499.787 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 93.244 | ||
| aromaticity | 0.048 | ||
| GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.219 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339103.1 | 5prime_partial | 177 | 756-223(-) |
Amino Acid sequence : | |||
| RDRPPYEGSGNYPPWWGRISPTYHAKMYNKTSKFKLFLLLTRNNQSINSRHHTTNQILRPRRREPRSLRHVDAAGTVAGGQFPVKALDHGPNHTCHLLNGQQHPRAAPPARSKRKKLEIL PFNINLGVFLLQKSLRPELRRIFPNVRVPPHRPNVDEQQRVCRNRVAADHAVGDRFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 12,499.787 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 93.244 | ||
| aromaticity | 0.048 | ||
| GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.219 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339103.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
| TIFDRRHRHDGDHLPMDNSRAHQQPYRPEESSKRDRHSRRSRQTFAGIRRPKFALPQRRHQRNFPASPSDPHALKKIDLRLRDRRLHDSGRHAAVRQHLVDGAEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,499.787 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 93.244 | ||
| aromaticity | 0.048 | ||
| GRAVY | -1.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.219 | ||
| sheet | 0.181 | ||