Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339118.1 | complete | 165 | 22-519(+) |
Amino Acid sequence : | |||
MEKGLKAFLSYVRAYKEHRCSFIFRWKELEIGKLGMGHGLLQLPSMSEVKHHSLSIKDFVPVEDIKLEDIKYKDKAREKQRKKNLAAKQAAKEQRKQEKPKAEAAKASNSMATSKKTAKQ RRAAQSAEDADELEREYRLLKKLKKGRISENEFAKLTGTEDLLSE* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 12,004.397 | ||
Theoretical pI: | 11.060 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 51.995 | ||
aromaticity | 0.047 | ||
GRAVY | -1.134 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.255 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339118.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
TLLTRHYGERTQGLSIVRSGLQRAPMFLHLQMERARNREAGNGTRSVAAPINVGSKTPLPLHQRFCPRRRYKTRGYQVQRQSSRKTKEEKPGSETGREGAEETGEA* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,004.397 | ||
Theoretical pI: | 11.060 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 51.995 | ||
aromaticity | 0.047 | ||
GRAVY | -1.134 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.255 | ||
sheet | 0.255 |