Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
SYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAA | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 193 | 1-582(+) |
Amino Acid sequence : | |||
SPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLI SPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 141 | 704-279(-) |
Amino Acid sequence : | |||
SSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGA AVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
LLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
SYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAA | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 193 | 1-582(+) |
Amino Acid sequence : | |||
SPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLI SPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 141 | 704-279(-) |
Amino Acid sequence : | |||
SSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRQALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGA AVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339122.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
LLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 14,350.574 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.092 | ||
aromaticity | 0.017 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.237 | ||
sheet | 0.229 |