| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339128.1 | 5prime_partial | 173 | 723-202(-) |
Amino Acid sequence : | |||
| VIPAKYLGDKTIFHLNPSGRFVIGGPHGDAGLPDRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLI KENFDFSPGMMAINLDLVRGGNFRYQKTAAYGHFGRDDPDFTWETVKILNPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,659.074 | ||
| Theoretical pI: | 9.163 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 10.476 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.266 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339128.1 | 5prime_partial | 173 | 723-202(-) |
Amino Acid sequence : | |||
| VIPAKYLGDKTIFHLNPSGRFVIGGPHGDAGLPDRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLI KENFDFSPGMMAINLDLVRGGNFRYQKTAAYGHFGRDDPDFTWETVKILNPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,659.074 | ||
| Theoretical pI: | 9.163 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 10.476 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.266 | ||
| sheet | 0.173 | ||