| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339129.1 | complete | 161 | 550-65(-) |
Amino Acid sequence : | |||
| MATSGAGAAVAVKYGGPMDVARHVLQSEGGARGLFKGLFPTMAREVPGNAAMFGVYEALKQYFAGGQDTSSLGRGSLILAGGLAGASFWASVYPTDVVKSVLQVDDYKNPKYSGSMDAFR KILKAEGVKGLYKVFGPAMARSVPANAACFLAYEVTRSSLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 10,414.773 | ||
| Theoretical pI: | 9.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.979 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.327 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339129.1 | 3prime_partial | 101 | 396-698(+) |
Amino Acid sequence : | |||
| MAAFPGTSRAMVGNSPLNRPLAPPSDWRTCLATSIGPPYFTATAAPAPDVAIALWACNLHLMSSGGQARNDTASPAPAPQTTCWLTVRGATGGRPQVGFHL | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,414.773 | ||
| Theoretical pI: | 9.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.979 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.327 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339129.1 | complete | 161 | 550-65(-) |
Amino Acid sequence : | |||
| MATSGAGAAVAVKYGGPMDVARHVLQSEGGARGLFKGLFPTMAREVPGNAAMFGVYEALKQYFAGGQDTSSLGRGSLILAGGLAGASFWASVYPTDVVKSVLQVDDYKNPKYSGSMDAFR KILKAEGVKGLYKVFGPAMARSVPANAACFLAYEVTRSSLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 10,414.773 | ||
| Theoretical pI: | 9.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.979 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.327 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339129.1 | 3prime_partial | 101 | 396-698(+) |
Amino Acid sequence : | |||
| MAAFPGTSRAMVGNSPLNRPLAPPSDWRTCLATSIGPPYFTATAAPAPDVAIALWACNLHLMSSGGQARNDTASPAPAPQTTCWLTVRGATGGRPQVGFHL | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,414.773 | ||
| Theoretical pI: | 9.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.979 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.327 | ||
| sheet | 0.277 | ||