| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339139.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| HPVKPQPKLPIVRRALPRSIRTSSTADFSNAANDSFACESSYEHSLSDPTDRRCIDTEPKILHLLSGCPNIVRLHDVYEDDDYIHLGTDLCDGGDLFDRISSGNRFSEPDAAAILKQLMT AGAYCHRLGGAHRDIKPDNILFDSRGRLKLADFGSAELFDVSDMNEVVGTPYYVAPEVLMGRDYNDKEDVW | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,299.526 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 42.909 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.246 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339139.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| HPVKPQPKLPIVRRALPRSIRTSSTADFSNAANDSFACESSYEHSLSDPTDRRCIDTEPKILHLLSGCPNIVRLHDVYEDDDYIHLGTDLCDGGDLFDRISSGNRFSEPDAAAILKQLMT AGAYCHRLGGAHRDIKPDNILFDSRGRLKLADFGSAELFDVSDMNEVVGTPYYVAPEVLMGRDYNDKEDVW | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,299.526 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 42.909 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.246 | ||
| sheet | 0.230 | ||