| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339150.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| TILISIFLLNSSFSPSKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHPTLD IVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIANRAVLPVENSLGGSNHRN | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 20,824.666 | ||
| Theoretical pI: | 11.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 56.762 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.173 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339150.1 | 5prime_partial | 185 | 650-93(-) |
Amino Acid sequence : | |||
| IPMIRTSKRILHRQHRSICDPKLNRLKRHLKLIARNRLAVRIRLTSGGFTVRAGDSLVSDAQLRAVHRRRREVGDTERLRERRRRRRVRLLLDWDYVERRVTVDDGDAVGALLGVLLLRL HLAGEYRARALPFVTRAAYLTGAEAQTGGGGGVETGIDVGGVETRGALDETRSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,824.666 | ||
| Theoretical pI: | 11.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 56.762 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.173 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339150.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| TILISIFLLNSSFSPSKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHPTLD IVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIANRAVLPVENSLGGSNHRN | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 20,824.666 | ||
| Theoretical pI: | 11.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 56.762 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.173 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339150.1 | 5prime_partial | 185 | 650-93(-) |
Amino Acid sequence : | |||
| IPMIRTSKRILHRQHRSICDPKLNRLKRHLKLIARNRLAVRIRLTSGGFTVRAGDSLVSDAQLRAVHRRRREVGDTERLRERRRRRRVRLLLDWDYVERRVTVDDGDAVGALLGVLLLRL HLAGEYRARALPFVTRAAYLTGAEAQTGGGGGVETGIDVGGVETRGALDETRSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,824.666 | ||
| Theoretical pI: | 11.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 56.762 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.173 | ||
| sheet | 0.270 | ||