| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339151.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| APIIIRKTVLFVQIWTLLNVSPSIAWCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLYIT DAFYGLVVVGPNGGLVTRVPGFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRTRIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLITEYIAPRIRRFWIKGAK SKF | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 26,534.330 | ||
| Theoretical pI: | 9.776 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 28.860 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.263 | ||
| sheet | 0.165 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339151.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| APIIIRKTVLFVQIWTLLNVSPSIAWCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLYIT DAFYGLVVVGPNGGLVTRVPGFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRTRIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLITEYIAPRIRRFWIKGAK SKF | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 26,534.330 | ||
| Theoretical pI: | 9.776 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 28.860 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.263 | ||
| sheet | 0.165 | ||