| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339152.1 | 5prime_partial | 190 | 627-55(-) |
Amino Acid sequence : | |||
| FQARNFAFLDPLDIAQSKGVVFFVDSGAIFLPANRTRIVESGDPSGRLFKYDIPPNQVPLILSGLSGPVGVPLTKDNSYFLIPEYIAQRIRRFWIKGAKANSSDVFPNVDGTPDTIKRTV LGAFWVAISTPNHPNPFSLGQRINRFGKFVETCNFPAQYNTPHGITEFQEYKGKLYVGSLAQNFIGVFGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,060.786 | ||
| Theoretical pI: | 9.442 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 20.714 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.300 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339152.1 | 5prime_partial | 190 | 627-55(-) |
Amino Acid sequence : | |||
| FQARNFAFLDPLDIAQSKGVVFFVDSGAIFLPANRTRIVESGDPSGRLFKYDIPPNQVPLILSGLSGPVGVPLTKDNSYFLIPEYIAQRIRRFWIKGAKANSSDVFPNVDGTPDTIKRTV LGAFWVAISTPNHPNPFSLGQRINRFGKFVETCNFPAQYNTPHGITEFQEYKGKLYVGSLAQNFIGVFGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,060.786 | ||
| Theoretical pI: | 9.442 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 20.714 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.300 | ||
| sheet | 0.158 | ||