| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339154.1 | 3prime_partial | 232 | 23-718(+) |
Amino Acid sequence : | |||
| MATSEVEVERSDVQLKHLGFVRVLAINAAVVVSNLYSYAKENSGTLKSTVGKVENAVATVVGPVYDRFQGVPGHILVFLDIKVDEAAQKFNECAPPAAKIAASKAQSIASTTSHLLQELV EEAKVDGPLAAVFHAGQISKAAAINGVALVWYKANHYPALHGVLEMAVPTAAHWSEKYNSIVKDLAAKGYSSFSYVPLVPVEEMEKAYKQVEAASDKKTDSGSSSQSDSDKE | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 13,188.397 | ||
| Theoretical pI: | 7.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.202 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339154.1 | 5prime_partial | 119 | 718-359(-) |
Amino Acid sequence : | |||
| LLIGIALAGAAGIGLLITGSLHLLICLLHLLHRHQRNVAERTVPLGRQVFNDAVVLLRPMCSCWNSHLQHSVQRRVVVGFVPHESYPIYCGCLGDLASVEDGCQWTVDFGFLDKFLQKM* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,188.397 | ||
| Theoretical pI: | 7.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.202 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339154.1 | 3prime_partial | 232 | 23-718(+) |
Amino Acid sequence : | |||
| MATSEVEVERSDVQLKHLGFVRVLAINAAVVVSNLYSYAKENSGTLKSTVGKVENAVATVVGPVYDRFQGVPGHILVFLDIKVDEAAQKFNECAPPAAKIAASKAQSIASTTSHLLQELV EEAKVDGPLAAVFHAGQISKAAAINGVALVWYKANHYPALHGVLEMAVPTAAHWSEKYNSIVKDLAAKGYSSFSYVPLVPVEEMEKAYKQVEAASDKKTDSGSSSQSDSDKE | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 13,188.397 | ||
| Theoretical pI: | 7.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.202 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339154.1 | 5prime_partial | 119 | 718-359(-) |
Amino Acid sequence : | |||
| LLIGIALAGAAGIGLLITGSLHLLICLLHLLHRHQRNVAERTVPLGRQVFNDAVVLLRPMCSCWNSHLQHSVQRRVVVGFVPHESYPIYCGCLGDLASVEDGCQWTVDFGFLDKFLQKM* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,188.397 | ||
| Theoretical pI: | 7.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.202 | ||
| sheet | 0.269 | ||