| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339157.1 | 5prime_partial | 191 | 1-576(+) |
Amino Acid sequence : | |||
| WSSALPNTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FFLRQVARDLHQVLSRAGFRRGRGHEENHRRMRGKGHKRGGEGLCYFSGVHGRFRHVENREQRRSSVDRSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 11,094.383 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 54.317 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.200 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339157.1 | 5prime_partial | 110 | 733-401(-) |
Amino Acid sequence : | |||
| AGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,094.383 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 54.317 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.200 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339157.1 | 3prime_partial | 100 | 434-733(+) |
Amino Acid sequence : | |||
| MKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAG | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,094.383 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 54.317 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.200 | ||
| sheet | 0.250 | ||