Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339157.1 | 5prime_partial | 191 | 1-576(+) |
Amino Acid sequence : | |||
WSSALPNTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FFLRQVARDLHQVLSRAGFRRGRGHEENHRRMRGKGHKRGGEGLCYFSGVHGRFRHVENREQRRSSVDRSA* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 11,094.383 | ||
Theoretical pI: | 5.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 54.317 | ||
aromaticity | 0.070 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.200 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339157.1 | 5prime_partial | 110 | 733-401(-) |
Amino Acid sequence : | |||
AGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,094.383 | ||
Theoretical pI: | 5.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 54.317 | ||
aromaticity | 0.070 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.200 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339157.1 | 3prime_partial | 100 | 434-733(+) |
Amino Acid sequence : | |||
MKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAG | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,094.383 | ||
Theoretical pI: | 5.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 54.317 | ||
aromaticity | 0.070 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.200 | ||
sheet | 0.250 |