| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339167.1 | 5prime_partial | 232 | 721-23(-) |
Amino Acid sequence : | |||
| NAFIIPTGKVVDTSLVQVVGITRVGVYIESFSGQFIVPRVDQHYTNQNLDPMEVAYEKLENGYALLGQKIAKPISTGFMELNGTDPNENPSVTFNYFNDSRDLQTCVDGLKIVERVVESR SISDYRYPNSTIESLKRFMLSHHINQRRKHESATSDLGQFCRDTVLTIWHYHGGCQVNRVVDRDYRVLGVDSLRVVDGSTFYDSPGTNPQATLMMLGRYMGQKILQQRGVGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,217.345 | ||
| Theoretical pI: | 7.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 27.580 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.250 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339167.1 | 5prime_partial | 232 | 721-23(-) |
Amino Acid sequence : | |||
| NAFIIPTGKVVDTSLVQVVGITRVGVYIESFSGQFIVPRVDQHYTNQNLDPMEVAYEKLENGYALLGQKIAKPISTGFMELNGTDPNENPSVTFNYFNDSRDLQTCVDGLKIVERVVESR SISDYRYPNSTIESLKRFMLSHHINQRRKHESATSDLGQFCRDTVLTIWHYHGGCQVNRVVDRDYRVLGVDSLRVVDGSTFYDSPGTNPQATLMMLGRYMGQKILQQRGVGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,217.345 | ||
| Theoretical pI: | 7.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 27.580 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.250 | ||
| sheet | 0.168 | ||