Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339168.1 | 5prime_partial | 221 | 1-666(+) |
Amino Acid sequence : | |||
APVRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVQNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELE IAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAVTARVSIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 13,574.340 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 58.202 | ||
aromaticity | 0.093 | ||
GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.372 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339168.1 | complete | 129 | 623-234(-) |
Amino Acid sequence : | |||
MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISNSEPVPIKITSGLLPDELSEIVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,574.340 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 58.202 | ||
aromaticity | 0.093 | ||
GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.372 | ||
sheet | 0.279 |