Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339171.1 | 5prime_partial | 237 | 2-715(+) |
Amino Acid sequence : | |||
SGKMAGAEAQPYQALRNWIDDATGFQGEAYGVRMRKLRRRTLLRDYWVSHMKAEFQNLGHANEPQSFTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKT VEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQPDAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 11,322.117 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 46.219 | ||
aromaticity | 0.101 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.141 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339171.1 | complete | 99 | 604-305(-) |
Amino Acid sequence : | |||
MPYIKAISNIQSNPWCIPSQNWIGFNQPTLCIWLELFEISNNITGKGFTTLPPCHILENGICRTLVQVLKNSCNFSRTKFHRLISYRGSVINSIACIHR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,322.117 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 46.219 | ||
aromaticity | 0.101 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.141 |