| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339175.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TSIFASPLARKLAEAHNVSLSEIKGTGPDGRIVKADIEDYLASRGKAAHAPKVDTTTVAGLDYTDIPHSQIRKVTASRLLQSKQTIPHYYLTVDTCVDKLMELRSQLNSLQEASGGKRIS VNDLVIKAAALALKKVPQCNSSWTNDYIRQYNNVNINVAVQTDNGLYVPVIRDADKKGLSIISEEVKHVAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAIINPPQAGILAVGSAE KRVIPGAGPDQYKFASFMSVT | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,211.794 | ||
| Theoretical pI: | 8.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 31.697 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.249 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339175.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TSIFASPLARKLAEAHNVSLSEIKGTGPDGRIVKADIEDYLASRGKAAHAPKVDTTTVAGLDYTDIPHSQIRKVTASRLLQSKQTIPHYYLTVDTCVDKLMELRSQLNSLQEASGGKRIS VNDLVIKAAALALKKVPQCNSSWTNDYIRQYNNVNINVAVQTDNGLYVPVIRDADKKGLSIISEEVKHVAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAIINPPQAGILAVGSAE KRVIPGAGPDQYKFASFMSVT | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,211.794 | ||
| Theoretical pI: | 8.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 31.697 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.249 | ||
| sheet | 0.226 | ||