| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339191.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| WHPVRISTMANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNI CFKYPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNE | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,637.596 | ||
| Theoretical pI: | 7.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 44.954 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.286 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339191.1 | 3prime_partial | 119 | 359-3(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILTGC | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,637.596 | ||
| Theoretical pI: | 7.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 44.954 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.286 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339191.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| WHPVRISTMANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNI CFKYPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNE | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,637.596 | ||
| Theoretical pI: | 7.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 44.954 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.286 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339191.1 | 3prime_partial | 119 | 359-3(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILTGC | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,637.596 | ||
| Theoretical pI: | 7.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 44.954 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.286 | ||
| sheet | 0.218 | ||