| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339201.1 | internal | 199 | 2-598(+) |
Amino Acid sequence : | |||
| FIDFLSNLHIFLIMEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDLDHHKDHGGSHKNHKPVNVNVSPLIYHYAAT ETQLHDSPNVALFFLEKDLYARNKMTLQFYKDSNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMNKTIQE | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 22,625.173 | ||
| Theoretical pI: | 5.721 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 46.958 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.216 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339201.1 | internal | 199 | 2-598(+) |
Amino Acid sequence : | |||
| FIDFLSNLHIFLIMEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDLDHHKDHGGSHKNHKPVNVNVSPLIYHYAAT ETQLHDSPNVALFFLEKDLYARNKMTLQFYKDSNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMNKTIQE | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 22,625.173 | ||
| Theoretical pI: | 5.721 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 46.958 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.216 | ||
| sheet | 0.226 | ||