Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339205.1 | 5prime_partial | 187 | 1-564(+) |
Amino Acid sequence : | |||
APVYMDDSDEDQRLPHHREPKEFVSLDKLAELGVLSWRLDADNYETDEELKKIREDRGYSYIDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYAVAGSGYFDVRDVNENWIRVWVKKG GMIVLPAGIYHRFTLDSSNYIKAMRLFVGDPIWTPYNRPHDHLPARQEYVETFVNADGAGRAVNAAA* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 21,829.088 | ||
Theoretical pI: | 4.943 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 29.103 | ||
aromaticity | 0.123 | ||
GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.193 | ||
sheet | 0.262 |