Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339208.1 | complete | 138 | 118-534(+) |
Amino Acid sequence : | |||
MSNFFAQPDALAYGKTPEQLLNENVPDHLITHKTFSGNRPSLSLLLPSLNAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHGSRKKGEPIEGFNFSTTALLKRY LEASNDISKEDCTILPKM* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,448.428 | ||
Theoretical pI: | 6.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 36.681 | ||
aromaticity | 0.094 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.268 | ||
sheet | 0.275 |