| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339208.1 | complete | 138 | 118-534(+) |
Amino Acid sequence : | |||
| MSNFFAQPDALAYGKTPEQLLNENVPDHLITHKTFSGNRPSLSLLLPSLNAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHGSRKKGEPIEGFNFSTTALLKRY LEASNDISKEDCTILPKM* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,448.428 | ||
| Theoretical pI: | 6.905 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 36.681 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.268 | ||
| sheet | 0.275 | ||