Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339209.1	5prime_partial	160	3-485(+)
Amino Acid sequence :
TLEPSEKVWAEVFYYLAENNVTFEGILLKPSMVTPGAEHKEKASPDTIAKHTLTMLRRRVPPAVPGIMFLSGGQSEVEATLNLNAMNQSPNPWHVSFSYARALQNSVLKTWQGRPENVEA AQKALLVRAKANSLAQLGKYSAEGENEEAKKGMFVKGYTY*
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,710.993
Theoretical pI:		8.775
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25440
Instability index:		43.396
aromaticity		0.088
GRAVY		-0.401
Secondary Structure Fraction
Helix		0.275
turn		0.256
sheet		0.331